SCOPe 2.06: Domain d2ifcc_: 2ifc C:

Lineage for d2ifcc_ (2ifc C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein automated matches [190675] (7 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [188213] (3 PDB entries)

8. Domain d2ifcc_: 2ifc C: [165534]
   automated match to d1o7xc_
   complexed with oaa

Details for d2ifcc_

PDB Entry: 2ifc, 1.7 Å

PDB Description: the structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum

PDB Compounds: (C:) citrate synthase

SCOPe Domain Sequences for d2ifcc_:

Sequence; same for both SEQRES and ATOM records:

>d2ifcc_ a.103.1.1 (C:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
teeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpte
qelrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrd
vaaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntali
lytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamv
ekwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledf
gikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrl
irpravyvgpaerkyvpiaerk

Timeline for d2ifcc_:

• d2ifcc_ first appeared in SCOPe 2.01
  
• d2ifcc_ appears in SCOPe 2.05
  
• d2ifcc_ appears in SCOPe 2.07
  
• d2ifcc_ appears in the current release, SCOPe 2.08