SCOPe 2.07: Domain d2ic7a_: 2ic7 A:

Lineage for d2ic7a_ (2ic7 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
   this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain

6. Protein automated matches [190704] (6 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [187850] (1 PDB entry)

8. Domain d2ic7a_: 2ic7 A: [165486]
   automated match to d1ocxa_

Details for d2ic7a_

PDB Entry: 2ic7, 1.78 Å

PDB Description: crystal structure of maltose transacetylase from geobacillus kaustophilus

PDB Compounds: (A:) Maltose transacetylase

SCOPe Domain Sequences for d2ic7a_:

Sequence; same for both SEQRES and ATOM records:

>d2ic7a_ b.81.1.3 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
mksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstger
lfiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphe
rnsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakv
ikwlk

Timeline for d2ic7a_:

• d2ic7a_ first appeared in SCOPe 2.01
  
• d2ic7a_ appears in SCOPe 2.06
  
• d2ic7a_ appears in the current release, SCOPe 2.08