SCOPe 2.01: Domain d2hy81_: 2hy8 1:

Lineage for d2hy81_ (2hy8 1:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein pak1 [56146] (1 species)
   OPK group; PAK/STE20 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56147] (9 PDB entries)

8. Domain d2hy81_: 2hy8 1: [165334]
   automated match to d1f3mc_
   complexed with 1st

Details for d2hy81_

PDB Entry: 2hy8, 2 Å

PDB Description: pak1 complex with st2001

PDB Compounds: (1:) Serine/threonine-protein kinase PAK 1

SCOPe Domain Sequences for d2hy81_:

Sequence; same for both SEQRES and ATOM records:

>d2hy81_ d.144.1.7 (1:) pak1 {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrsemvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeat

Timeline for d2hy81_:

• d2hy81_ is new in SCOPe 2.01-stable
  
• d2hy81_ appears in SCOPe 2.02
  
• d2hy81_ appears in the current release, SCOPe 2.08