Lineage for d2hx1a_ (2hx1 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1188163Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1188164Protein automated matches [190447] (25 species)
    not a true protein
  7. 1188193Species Cytophaga hutchinsonii [TaxId:985] [187831] (1 PDB entry)
  8. 1188194Domain d2hx1a_: 2hx1 A: [165316]
    automated match to d1pw5a_
    complexed with cl, edo, epe, mg

Details for d2hx1a_

PDB Entry: 2hx1 (more details), 2.1 Å

PDB Description: crystal structure of possible sugar phosphatase, had superfamily (zp_00311070.1) from cytophaga hutchinsonii atcc 33406 at 2.10 a resolution
PDB Compounds: (A:) Predicted sugar phosphatases of the HAD superfamily

SCOPe Domain Sequences for d2hx1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hx1a_ c.108.1.0 (A:) automated matches {Cytophaga hutchinsonii [TaxId: 985]}
gmqiesfksllpkykciffdafgvlktyngllpgientfdylkaqgqdyyivtndasrsp
eqladsyhklglfsitadkiissgmitkeyidlkvdggivaylgtansanylvsdgikml
pvsaiddsnigevnalvllddegfnwfhdlnktvnllrkrtipaivantdntypltktdv
aiaiggvatmiesilgrrfirfgkpdsqmfmfaydmlrqkmeiskreilmvgdtlhtdil
ggnkfgldtalvltgntriddaetkikstgivpthicesaviel

SCOPe Domain Coordinates for d2hx1a_:

Click to download the PDB-style file with coordinates for d2hx1a_.
(The format of our PDB-style files is described here.)

Timeline for d2hx1a_: