Lineage for d2hunb_ (2hun B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1153904Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1153905Protein automated matches [190069] (73 species)
    not a true protein
  7. 1154169Species Pyrococcus horikoshii [TaxId:70601] [187049] (1 PDB entry)
  8. 1154171Domain d2hunb_: 2hun B: [165285]
    automated match to d1r66a_
    complexed with nad

Details for d2hunb_

PDB Entry: 2hun (more details), 2.07 Å

PDB Description: Crystal structure of hypothetical protein PH0414 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) 336aa long hypothetical dTDP-glucose 4,6-dehydratase

SCOPe Domain Sequences for d2hunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hunb_ c.2.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mhsmkllvtggmgfigsnfiryilekhpdwevinidklgygsnpanlkdleddprytfvk
gdvadyelvkelvrkvdgvvhlaaeshvdrsisspeiflhsnvigtytllesirrenpev
rfvhvstdevygdilkgsftendrlmpsspysatkaasdmlvlgwtrtynlnasitrctn
nygpyqfpeklipktiiraslglkipiygtgknvrdwlyvedhvraielvllkgesreiy
nisageektnlevvkiilrlmgkgeelielvedrpghdlrysldswkitrdlkwrpkytf
degikktidwylknewwwkplvder

SCOPe Domain Coordinates for d2hunb_:

Click to download the PDB-style file with coordinates for d2hunb_.
(The format of our PDB-style files is described here.)

Timeline for d2hunb_: