Lineage for d2h8qd_ (2h8q D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899128Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species)
  7. 1899129Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries)
  8. 1899141Domain d2h8qd_: 2h8q D: [165013]
    automated match to d1g7ka_
    mutant

Details for d2h8qd_

PDB Entry: 2h8q (more details), 2 Å

PDB Description: crystal structure of a redshifted mutant (k83m) of the red fluorescent protein drfp583/dsred
PDB Compounds: (D:) red fluorescent protein drfp583

SCOPe Domain Sequences for d2h8qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8qd_ d.22.1.1 (D:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]}
vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq
ygskvyvkhpadipdymklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig
vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp
vqlpgyyyvdsklditshnedytiveqyertegrhhlfl

SCOPe Domain Coordinates for d2h8qd_:

Click to download the PDB-style file with coordinates for d2h8qd_.
(The format of our PDB-style files is described here.)

Timeline for d2h8qd_: