Lineage for d2h5ra1 (2h5r A:6-224)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547337Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries)
  8. 2547359Domain d2h5ra1: 2h5r A:6-224 [164955]
    Other proteins in same PDB: d2h5ra2
    automated match to d1g7ka_

Details for d2h5ra1

PDB Entry: 2h5r (more details), 1.6 Å

PDB Description: Crystal structure of mStrawberry at pH 10.5
PDB Compounds: (A:) mStrawberry

SCOPe Domain Sequences for d2h5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h5ra1 d.22.1.1 (A:6-224) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkvrmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdiltpnf
gygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
gtmfpsdgpvmqkktmgweassermypedgalkgeikmrlklkdgghydaevkttykakk
pvqlpgayivgiklditshnedytivelyeraegrhstg

SCOPe Domain Coordinates for d2h5ra1:

Click to download the PDB-style file with coordinates for d2h5ra1.
(The format of our PDB-style files is described here.)

Timeline for d2h5ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h5ra2