SCOPe 2.06: Domain d2h47e_: 2h47 E:

Lineage for d2h47e_ (2h47 E:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.0: automated matches [191380] (1 protein)
   not a true family

6. Protein automated matches [190474] (1 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)

8. Domain d2h47e_: 2h47 E: [164933]
   Other proteins in same PDB: d2h47c_
   automated match to d1mg2b_
   complexed with cu

Details for d2h47e_

PDB Entry: 2h47, 2.6 Å

PDB Description: Crystal Structure of an Electron Transfer Complex Between Aromatic Amine Dephydrogenase and Azurin from Alcaligenes Faecalis (Form 1)

PDB Compounds: (E:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2h47e_:

Sequence; same for both SEQRES and ATOM records:

>d2h47e_ g.21.1.0 (E:) automated matches {Alcaligenes faecalis [TaxId: 511]}
dhislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnph
dgkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlv
glakn

Timeline for d2h47e_:

• d2h47e_ first appeared in SCOPe 2.01
  
• d2h47e_ appears in SCOPe 2.05
  
• d2h47e_ appears in SCOPe 2.07
  
• d2h47e_ appears in the current release, SCOPe 2.08