Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (8 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [187784] (4 PDB entries) |
Domain d2h3xf_: 2h3x F: [164930] Other proteins in same PDB: d2h3xb_, d2h3xe_ automated match to d1dyza_ complexed with cu |
PDB Entry: 2h3x (more details), 2.5 Å
SCOPe Domain Sequences for d2h3xf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3xf_ b.6.1.1 (F:) automated matches {Alcaligenes faecalis [TaxId: 511]} acdvsiegndsmqfntksivvdktckeftinlkhtgklpkaamghnvvvskksdesavat dgmkaglnndyvkagderviahtsvigggetdsvtfdvsklkegedyaffcsfpghwsim kgtielgs
Timeline for d2h3xf_: