Lineage for d2h3xb_ (2h3x B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064542Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1064543Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1064601Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 1064602Protein automated matches [190474] (1 species)
    not a true protein
  7. 1064603Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 1064654Domain d2h3xb_: 2h3x B: [164927]
    Other proteins in same PDB: d2h3xc_, d2h3xf_
    automated match to d1mg2b_
    complexed with cu

Details for d2h3xb_

PDB Entry: 2h3x (more details), 2.5 Å

PDB Description: Crystal Structure of an Electron Transfer Complex Between Aromatic Amine Dehydrogenase and Azurin from Alcaligenes Faecalis (Form 3)
PDB Compounds: (B:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2h3xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3xb_ g.21.1.0 (B:) automated matches {Alcaligenes faecalis [TaxId: 511]}
adhislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnp
hdgkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvl
vglak

SCOPe Domain Coordinates for d2h3xb_:

Click to download the PDB-style file with coordinates for d2h3xb_.
(The format of our PDB-style files is described here.)

Timeline for d2h3xb_: