SCOPe 2.03: Domain d2gzxb_: 2gzx B:

Lineage for d2gzxb_ (2gzx B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (16 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:196620] [187776] (1 PDB entry)

8. Domain d2gzxb_: 2gzx B: [164884]
   automated match to d1j6oa_
   complexed with ni

Details for d2gzxb_

PDB Entry: 2gzx, 2.2 Å

PDB Description: crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237.

PDB Compounds: (B:) putative TatD related DNase

SCOPe Domain Sequences for d2gzxb_:

Sequence; same for both SEQRES and ATOM records:

>d2gzxb_ c.1.9.0 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
lidthvhlndeqydddlsevitrareagvdrmfvvgfnkstieramklideydflygiig
whpvdaidfteehlewieslaqhpkvigigemgldyhwdkspadvqkevfrkqialakrl
klpiiihnreatqdcidilleehaeevggimhsfsgspeiadivtnklnfyislggpvtf
knakqpkevakhvsmerllvetdapylsphpyrgkrneparvtlvaeqiaelkglsyeev
ceqttknaeklfn

Timeline for d2gzxb_:

• d2gzxb_ first appeared in SCOPe 2.01
  
• d2gzxb_ appears in SCOPe 2.02
  
• d2gzxb_ appears in SCOPe 2.04
  
• d2gzxb_ appears in the current release, SCOPe 2.08