Lineage for d2gzxa_ (2gzx A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1342051Family c.1.9.0: automated matches [191327] (1 protein)
    not a true family
  6. 1342052Protein automated matches [190150] (16 species)
    not a true protein
  7. 1342112Species Staphylococcus aureus [TaxId:196620] [187776] (1 PDB entry)
  8. 1342113Domain d2gzxa_: 2gzx A: [164883]
    automated match to d1j6oa_
    complexed with ni

Details for d2gzxa_

PDB Entry: 2gzx (more details), 2.2 Å

PDB Description: crystal structure of the tatd deoxyribonuclease mw0446 from staphylococcus aureus. northeast structural genomics consortium target zr237.
PDB Compounds: (A:) putative TatD related DNase

SCOPe Domain Sequences for d2gzxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzxa_ c.1.9.0 (A:) automated matches {Staphylococcus aureus [TaxId: 196620]}
lidthvhlndeqydddlsevitrareagvdrmfvvgfnkstieramklideydflygiig
whpvdaidfteehlewieslaqhpkvigigemgldyhwdkspadvqkevfrkqialakrl
klpiiihnreatqdcidilleehaeevggimhsfsgspeiadivtnklnfyislggpvtf
knakqpkevakhvsmerllvetdapylsphpyrgkrneparvtlvaeqiaelkglsyeev
ceqttknaeklfn

SCOPe Domain Coordinates for d2gzxa_:

Click to download the PDB-style file with coordinates for d2gzxa_.
(The format of our PDB-style files is described here.)

Timeline for d2gzxa_: