SCOPe 2.05: Domain d2gnwa_: 2gnw A:

Lineage for d2gnwa_ (2gnw A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Non-symbiotic plant hemoglobin [46484] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [46485] (3 PDB entries)

8. Domain d2gnwa_: 2gnw A: [164778]
   automated match to d1d8ua_
   complexed with hem; mutant

Details for d2gnwa_

PDB Entry: 2gnw, 2.4 Å

PDB Description: crystal structure of non-symbiotic plant hemoglobin from rice, b10 mutant f40w

PDB Compounds: (A:) Non-symbiotic hemoglobin 1

SCOPe Domain Sequences for d2gnwa_:

Sequence; same for both SEQRES and ATOM records:

>d2gnwa_ a.1.1.2 (A:) Non-symbiotic plant hemoglobin {Rice (Oryza sativa) [TaxId: 4530]}
alvednnavavsfseeqealvlkswailkkdsanialrfwlkifevapsasqmfsflrns
dvpleknpklkthamsvfvmtceaaaqlrkagkvtvrdttlkrlgathlkygvgdahfev
vkfalldtikeevpadmwspamksawseaydhlvaaikqemkpae

Timeline for d2gnwa_:

• d2gnwa_ first appeared in SCOPe 2.01
  
• d2gnwa_ appears in SCOPe 2.04
  
• d2gnwa_ appears in SCOPe 2.06
  
• d2gnwa_ appears in the current release, SCOPe 2.08