Lineage for d2gknb_ (2gkn B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976412Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1976413Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 1976422Species Mycobacterium tuberculosis, HbN [TaxId:1773] [63437] (8 PDB entries)
    Uniprot Q10784
  8. 1976436Domain d2gknb_: 2gkn B: [164745]
    automated match to d1s56b_
    complexed with cyn, hem, na; mutant

Details for d2gknb_

PDB Entry: 2gkn (more details), 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis trhbn, glne11val mutant
PDB Compounds: (B:) Hemoglobin-like protein HbN

SCOPe Domain Sequences for d2gknb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gknb_ a.1.1.1 (B:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}
gllsrlrkrepisiydkiggheaievvvedfyvrvladdqlsaffsgtnmsrlkgkvvef
faaalggpepytgapmkqvhqgrgitmhhfslvaghladaltaagvpsetiteilgviap
lavdvt

SCOPe Domain Coordinates for d2gknb_:

Click to download the PDB-style file with coordinates for d2gknb_.
(The format of our PDB-style files is described here.)

Timeline for d2gknb_: