SCOP 1.67: Domain d1aoib_: 1aoi B:

Lineage for d1aoib_ (1aoi B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (19 PDB entries)

8. Domain d1aoib_: 1aoi B: [16470]
   Other proteins in same PDB: d1aoia_, d1aoic_, d1aoid_, d1aoie_, d1aoig_, d1aoih_

Details for d1aoib_

PDB Entry: 1aoi, 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoib_:

Sequence; same for both SEQRES and ATOM records:

>d1aoib_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis)}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

Timeline for d1aoib_:

• d1aoib_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoib_ appears in SCOP 1.65
  
• d1aoib_ appears in SCOP 1.69
  
• d1aoib_ appears in the current release, SCOPe 2.08