Lineage for d2ghcx_ (2ghc X:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1496989Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1496990Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1496991Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1496992Protein Ascorbate peroxidase [48123] (3 species)
  7. 1496998Species Soybean (Glycine max) [TaxId:3847] [89092] (9 PDB entries)
    Uniprot Q43758
  8. 1496999Domain d2ghcx_: 2ghc X: [164698]
    automated match to d1oafa_
    complexed with hem, na, no

Details for d2ghcx_

PDB Entry: 2ghc (more details), 1.25 Å

PDB Description: conformational mobility in the active site of a heme peroxidase
PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOPe Domain Sequences for d2ghcx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghcx_ a.93.1.1 (X:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfad

SCOPe Domain Coordinates for d2ghcx_:

Click to download the PDB-style file with coordinates for d2ghcx_.
(The format of our PDB-style files is described here.)

Timeline for d2ghcx_: