SCOPe 2.01: Domain d2ghcx_: 2ghc X:

Lineage for d2ghcx_ (2ghc X:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (9 PDB entries)
   Uniprot Q43758

8. Domain d2ghcx_: 2ghc X: [164698]
   automated match to d1oafa_
   complexed with hem, na, no

Details for d2ghcx_

PDB Entry: 2ghc, 1.25 Å

PDB Description: conformational mobility in the active site of a heme peroxidase

PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOPe Domain Sequences for d2ghcx_:

Sequence; same for both SEQRES and ATOM records:

>d2ghcx_ a.93.1.1 (X:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlaahsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfad

Timeline for d2ghcx_:

• d2ghcx_ is new in SCOPe 2.01-stable
  
• d2ghcx_ appears in SCOPe 2.02
  
• d2ghcx_ appears in the current release, SCOPe 2.08, called d2ghcx1