Lineage for d2geba1 (2geb A:1-180)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499547Protein automated matches [190074] (15 species)
    not a true protein
  7. 2499606Species Thermoanaerobacter tengcongensis [TaxId:119072] [187747] (1 PDB entry)
  8. 2499607Domain d2geba1: 2geb A:1-180 [164669]
    Other proteins in same PDB: d2geba2
    automated match to d1r3ua_
    complexed with ca; mutant

Details for d2geba1

PDB Entry: 2geb (more details), 1.7 Å

PDB Description: crystal structure of the thermoanaerobacter tengcongensis hypoxanthine-guanine phosphoribosyltransferase l160i mutant: insights into the inhibitor design
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d2geba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2geba1 c.61.1.1 (A:1-180) automated matches {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mpspmedieeiliteeqlkakvkelgemitrdyegkdlvligvlkgaimfmsglsraidl
plsidflavssygsstkssgivkiikdhdidiegkdvlivediidsgltlaylretllgr
kprslkictildkperreadvkvdycgfkipdkfvvgygidyaekyrnlpfigvlkpely

SCOPe Domain Coordinates for d2geba1:

Click to download the PDB-style file with coordinates for d2geba1.
(The format of our PDB-style files is described here.)

Timeline for d2geba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2geba2