SCOPe 2.06: Domain d2ftox_: 2fto X:

Lineage for d2ftox_ (2fto X:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)

8. Domain d2ftox_: 2fto X: [164467]
   automated match to d1an5a_
   complexed with cb3, po4, tmp; mutant

Details for d2ftox_

PDB Entry: 2fto, 2 Å

PDB Description: y94f mutant of thymidylate synthase bound to thymidine-5'-phosphate and 10-propargyl-5,8-dideazafolid acid

PDB Compounds: (X:) Thymidylate synthase

SCOPe Domain Sequences for d2ftox_:

Sequence; same for both SEQRES and ATOM records:

>d2ftox_ d.117.1.1 (X:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvfgkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d2ftox_:

• d2ftox_ first appeared in SCOPe 2.01
  
• d2ftox_ appears in SCOPe 2.05
  
• d2ftox_ appears in SCOPe 2.07
  
• d2ftox_ appears in the current release, SCOPe 2.08