SCOPe 2.02: Domain d2fddb_: 2fdd B:

Lineage for d2fddb_ (2fdd B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (38 PDB entries)

8. Domain d2fddb_: 2fdd B: [164335]
   automated match to d1rpia_
   complexed with 385

Details for d2fddb_

PDB Entry: 2fdd, 1.58 Å

PDB Description: crystal structure of hiv protease d545701 bound with gw0385

PDB Compounds: (B:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2fddb_:

Sequence; same for both SEQRES and ATOM records:

>d2fddb_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikiggqqrealldtgaddtvledinlpgrwkpkiiggvggfvkvrqyd
qvpieicghkvigtvlvgptpaniigrnlmtqigctlnf

Timeline for d2fddb_:

• d2fddb_ first appeared in SCOPe 2.01
  
• d2fddb_ appears in SCOPe 2.03
  
• d2fddb_ appears in the current release, SCOPe 2.08