SCOPe 2.04: Domain d2egra_: 2egr A:

Lineage for d2egra_ (2egr A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (26 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries)

8. Domain d2egra_: 2egr A: [164015]
   automated match to d1z54a1

Details for d2egra_

PDB Entry: 2egr, 1.8 Å

PDB Description: Crystal Structure of Hypothetical Protein(AQ1494) from Aquifex aeolicus

PDB Compounds: (A:) Hypothetical protein aq_1494

SCOPe Domain Sequences for d2egra_:

Sequence; same for both SEQRES and ATOM records:

>d2egra_ d.38.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipke
vlevlk

Timeline for d2egra_:

• d2egra_ first appeared in SCOPe 2.01
  
• d2egra_ appears in SCOPe 2.03
  
• d2egra_ appears in SCOPe 2.05
  
• d2egra_ appears in the current release, SCOPe 2.08