Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.63: CYTH-like phosphatases [55153] (1 superfamily) duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it |
Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) |
Family d.63.1.0: automated matches [191434] (1 protein) not a true family |
Protein automated matches [190625] (3 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [187660] (1 PDB entry) |
Domain d2eena_: 2een A: [163961] automated match to d1yemb_ |
PDB Entry: 2een (more details), 1.65 Å
SCOPe Domain Sequences for d2eena_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eena_ d.63.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} yevelkgyandeifekvretfefmrkeihediyyqhpcrdfsktdealririkrfnghne vfltykgpkideksktrleieveiqedvdkyfelldrlgfkevlkvvktrekyyvekgvt itldeveglgkfieietlvkekdeipeaveklekilrelgvekferrsylelllekr
Timeline for d2eena_: