Lineage for d2eb6a_ (2eb6 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1942890Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 1942891Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 1942975Family d.177.1.0: automated matches [191367] (1 protein)
    not a true family
  6. 1942976Protein automated matches [190444] (2 species)
    not a true protein
  7. 1942982Species Escherichia coli [TaxId:562] [187351] (3 PDB entries)
  8. 1942988Domain d2eb6a_: 2eb6 A: [163941]
    automated match to d1sv6a_
    complexed with mg

Details for d2eb6a_

PDB Entry: 2eb6 (more details), 1.69 Å

PDB Description: Crystal structure of HpcG complexed with Mg ion
PDB Compounds: (A:) 2-oxo-hept-3-ene-1,7-dioate hydratase

SCOPe Domain Sequences for d2eb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eb6a_ d.177.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mfdkhthtliaqrldqaekqreqiraisldypeitiedayavqrewvrlkiaegrtlkgh
kigltskamqassqisepdygallddmffhdgsdiptdrfivprievelafvlakplrgp
nctlfdvynatdyvipalelidarchnidpetqrprkvfdtisdnaanagvilggrpikp
deldlrwisalmyrngvieetgvaagvlnhpangvawlanklapydvqleagqiilggsf
trpvparkgdtfhvdygnmgsiscrfv

SCOPe Domain Coordinates for d2eb6a_:

Click to download the PDB-style file with coordinates for d2eb6a_.
(The format of our PDB-style files is described here.)

Timeline for d2eb6a_: