Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
Superfamily d.177.1: FAH [56529] (2 families) |
Family d.177.1.0: automated matches [191367] (1 protein) not a true family |
Protein automated matches [190444] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [187351] (3 PDB entries) |
Domain d2eb5e_: 2eb5 E: [163940] automated match to d1sv6a_ complexed with mg, oxl, scn |
PDB Entry: 2eb5 (more details), 1.7 Å
SCOPe Domain Sequences for d2eb5e_:
Sequence, based on SEQRES records: (download)
>d2eb5e_ d.177.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]} mfdkhthtliaqrldqaekqreqiraisldypeitiedayavqrewvrlkiaegrtlkgh kigltskamqassqisepdygallddmffhdgsdiptdrfivprievelafvlakplrgp nctlfdvynatdyvipalelidarchnidpetqrprkvfdtisdnaanagvilggrpikp deldlrwisalmyrngvieetgvaagvlnhpangvawlanklapydvqleagqiilggsf trpvparkgdtfhvdygnmgsiscrfv
>d2eb5e_ d.177.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]} mfdkhthtliaqrldqaekqreqiraisldypeitiedayavqrewvrlkiaegrtlkgh kigltskamqasqisepdygallddmffhdgsdiptdrfivprievelafvlakplrgpn ctlfdvynatdyvipalelidarchnikvfdtisdnaanagvilggrpikpdeldlrwis almyrngvieetgvaagvlnhpangvawlanklapydvqleagqiilggsftrpvparkg dtfhvdygnmgsiscrfv
Timeline for d2eb5e_:
View in 3D Domains from other chains: (mouse over for more information) d2eb5a_, d2eb5b_, d2eb5c_, d2eb5d_ |