Lineage for d1dk1a_ (1dk1 A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150922Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 150923Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 150930Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 150931Protein Ribosomal protein S15 [47065] (2 species)
  7. 150934Species Thermus thermophilus [TaxId:274] [47067] (14 PDB entries)
  8. 150935Domain d1dk1a_: 1dk1 A: [16385]

Details for d1dk1a_

PDB Entry: 1dk1 (more details), 2.8 Å

PDB Description: detailed view of a key element of the ribosome assembly: crystal structure of the s15-rrna complex

SCOP Domain Sequences for d1dk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk1a_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyrmlieklgi

SCOP Domain Coordinates for d1dk1a_:

Click to download the PDB-style file with coordinates for d1dk1a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk1a_: