PDB entry 1dk1

View 1dk1 on RCSB PDB site
Description: detailed view of a key element of the ribosome assembly: crystal structure of the s15-rrna complex
Deposited on 1999-12-06, released 2000-04-02
The last revision prior to the SCOP 1.61 freeze date was dated 2000-04-02, with a file datestamp of 2000-04-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1dk1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dk1A (A:)
  pitkeekqkvmqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
  qrrrllrylqredperyrmlieklgi