Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186903] (4 PDB entries) |
Domain d2e0oa_: 2e0o A: [163789] automated match to d1dzaa_ complexed with gol, so4; mutant |
PDB Entry: 2e0o (more details), 2 Å
SCOPe Domain Sequences for d2e0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e0oa_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kesrakkfqrqhmdsdsspsssstycnqmmrrrnmtqgrckpvntfvheplllvqlvclq ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf dasved
Timeline for d2e0oa_: