Lineage for d2cwpa_ (2cwp A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1125613Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1125614Protein automated matches [190576] (6 species)
    not a true protein
  7. 1125626Species Pyrococcus horikoshii [TaxId:53953] [187575] (1 PDB entry)
  8. 1125627Domain d2cwpa_: 2cwp A: [163483]
    automated match to d1pyba_

Details for d2cwpa_

PDB Entry: 2cwp (more details), 2.1 Å

PDB Description: Crystal structure of MetRS related protein from Pyrococcus horikoshii
PDB Compounds: (A:) MetRS related protein

SCOPe Domain Sequences for d2cwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwpa_ b.40.4.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
melydvdefwkfqmkvglvkkaekikrtkkliklivdfgneertivtgiadqippeeleg
kkfifvvnlkpkkfsgvesqgmlilaetedgkvylipvpeevpvgarvw

SCOPe Domain Coordinates for d2cwpa_:

Click to download the PDB-style file with coordinates for d2cwpa_.
(The format of our PDB-style files is described here.)

Timeline for d2cwpa_: