Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (6 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [187575] (1 PDB entry) |
Domain d2cwpa_: 2cwp A: [163483] automated match to d1pyba_ |
PDB Entry: 2cwp (more details), 2.1 Å
SCOPe Domain Sequences for d2cwpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwpa_ b.40.4.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} melydvdefwkfqmkvglvkkaekikrtkkliklivdfgneertivtgiadqippeeleg kkfifvvnlkpkkfsgvesqgmlilaetedgkvylipvpeevpvgarvw
Timeline for d2cwpa_: