SCOPe 2.04: Domain d2c4wa_: 2c4w A:

Lineage for d2c4wa_ (2c4w A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
   automatically mapped to Pfam PF01220

6. Protein automated matches [190071] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries)

8. Domain d2c4wa_: 2c4w A: [163261]
   automated match to d1j2ya_
   complexed with gaj, gol, imd

Details for d2c4wa_

PDB Entry: 2c4w, 1.55 Å

PDB Description: type ii dehydroquinase from h. pylori in complex with ah9095

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2c4wa_:

Sequence; same for both SEQRES and ATOM records:

>d2c4wa_ c.23.13.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
aglvprgshmkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffq
tnfegeiidkiqesvgseyegiiinpgafshtsiaiadaimlagkpvievhltniqaree
frknsytgaacggvimgfgplgynmalmamvnilaemkafqeaqknnp

Timeline for d2c4wa_:

• d2c4wa_ first appeared in SCOPe 2.01
  
• d2c4wa_ appears in SCOPe 2.03
  
• d2c4wa_ appears in SCOPe 2.05
  
• d2c4wa_ appears in the current release, SCOPe 2.08, called d2c4wa1