Lineage for d2c4wa_ (2c4w A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1357747Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1357748Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1357869Protein automated matches [190071] (4 species)
    not a true protein
  7. 1357870Species Helicobacter pylori [TaxId:210] [187015] (6 PDB entries)
  8. 1357871Domain d2c4wa_: 2c4w A: [163261]
    automated match to d1j2ya_
    complexed with gaj, gol, imd

Details for d2c4wa_

PDB Entry: 2c4w (more details), 1.55 Å

PDB Description: type ii dehydroquinase from h. pylori in complex with ah9095
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2c4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4wa_ c.23.13.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
aglvprgshmkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffq
tnfegeiidkiqesvgseyegiiinpgafshtsiaiadaimlagkpvievhltniqaree
frknsytgaacggvimgfgplgynmalmamvnilaemkafqeaqknnp

SCOPe Domain Coordinates for d2c4wa_:

Click to download the PDB-style file with coordinates for d2c4wa_.
(The format of our PDB-style files is described here.)

Timeline for d2c4wa_: