![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
![]() | Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
![]() | Protein automated matches [190071] (4 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [187015] (6 PDB entries) |
![]() | Domain d2c4wa_: 2c4w A: [163261] automated match to d1j2ya_ complexed with gaj, gol, imd |
PDB Entry: 2c4w (more details), 1.55 Å
SCOPe Domain Sequences for d2c4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4wa_ c.23.13.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]} aglvprgshmkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffq tnfegeiidkiqesvgseyegiiinpgafshtsiaiadaimlagkpvievhltniqaree frknsytgaacggvimgfgplgynmalmamvnilaemkafqeaqknnp
Timeline for d2c4wa_: