Lineage for d2bzca_ (2bzc A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114377Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1114706Protein Plastocyanin [49507] (16 species)
  7. 1114713Species Dryopteris crassirhizoma [TaxId:97234] [187501] (2 PDB entries)
  8. 1114715Domain d2bzca_: 2bzc A: [163207]
    automated match to d1kdia_
    complexed with cu1; mutant

Details for d2bzca_

PDB Entry: 2bzc (more details), 1.79 Å

PDB Description: oxidized and reduced structures of a mutant plastocyanin of fern
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d2bzca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzca_ b.6.1.1 (A:) Plastocyanin {Dryopteris crassirhizoma [TaxId: 97234]}
akvevgdevgnfkfypdsitvsageaveftlvgetphnivfdipagapgtvaselkaasm
dendllsedepsfkakvstpgtytfyctphksanmkgtltvk

SCOPe Domain Coordinates for d2bzca_:

Click to download the PDB-style file with coordinates for d2bzca_.
(The format of our PDB-style files is described here.)

Timeline for d2bzca_: