Lineage for d2bg7b_ (2bg7 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231215Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2231216Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2231217Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2231369Protein automated matches [190079] (9 species)
    not a true protein
  7. 2231372Species Bacillus cereus [TaxId:1396] [187455] (15 PDB entries)
  8. 2231385Domain d2bg7b_: 2bg7 B: [163076]
    automated match to d1bc2a_
    complexed with gol, so4, zn; mutant

Details for d2bg7b_

PDB Entry: 2bg7 (more details), 2.1 Å

PDB Description: bacillus cereus metallo-beta-lactamase (bcii) arg (121) cys mutant. solved at ph4.5 using 20 micromolar znso4 in the buffer. 1mm dtt was used as a reducing agent. cys221 is oxidized.
PDB Compounds: (B:) beta-lactamase II

SCOPe Domain Sequences for d2bg7b_:

Sequence, based on SEQRES records: (download)

>d2bg7b_ d.157.1.1 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltk
eliemvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplg
dlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvaday
vnewstsienvlkryrninavvpghgevgdkglllhtldllk

Sequence, based on observed residues (ATOM records): (download)

>d2bg7b_ d.157.1.1 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
ktviknetgtisisqlnknvwvhtelgseavpsnglvlntskglvlvdsswddkltkeli
emvekkfqkrvtdviithahadciggiktlkergikahstaltaelakkngyeeplgdlq
tvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayvne
wstsienvlkryrninavvpghgevgdkglllhtldllk

SCOPe Domain Coordinates for d2bg7b_:

Click to download the PDB-style file with coordinates for d2bg7b_.
(The format of our PDB-style files is described here.)

Timeline for d2bg7b_: