Lineage for d2beab_ (2bea B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791370Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1791371Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
    automatically mapped to Pfam PF00197
  6. 1791408Protein automated matches [190504] (2 species)
    not a true protein
  7. 1791411Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (12 PDB entries)
  8. 1791417Domain d2beab_: 2bea B: [163053]
    automated match to d1wbca_
    mutant

Details for d2beab_

PDB Entry: 2bea (more details), 2.35 Å

PDB Description: crystal structure of asn14 to gly mutant of wci
PDB Compounds: (B:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d2beab_:

Sequence, based on SEQRES records: (download)

>d2beab_ b.42.4.1 (B:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dlvdaegnlvegggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiriss
qflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfekv
shsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkak

Sequence, based on observed residues (ATOM records): (download)

>d2beab_ b.42.4.1 (B:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dlvdaegnlvegggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiriss
qflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfekv
shsnihvykllycqhvkcdqyigihrdrngnrrlvvteenplelvllkak

SCOPe Domain Coordinates for d2beab_:

Click to download the PDB-style file with coordinates for d2beab_.
(The format of our PDB-style files is described here.)

Timeline for d2beab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2beaa_