![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein automated matches [190433] (10 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (21 PDB entries) |
![]() | Domain d2b60a_: 2b60 A: [162995] automated match to d1sgua_ complexed with gol, rit; mutant |
PDB Entry: 2b60 (more details), 2.2 Å
SCOPe Domain Sequences for d2b60a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b60a_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfikvrqyd qipieicghkvigtvlvgptpaniigrnlmtqigctlnf
Timeline for d2b60a_: