Lineage for d2b3rb_ (2b3r B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 941314Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 941315Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 941452Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 941453Protein automated matches [190497] (3 species)
    not a true protein
  7. 941457Species Mouse (Mus musculus) [TaxId:10090] [187441] (1 PDB entry)
  8. 941459Domain d2b3rb_: 2b3r B: [162990]
    automated match to d2bwqa1
    complexed with so4

Details for d2b3rb_

PDB Entry: 2b3r (more details), 2.3 Å

PDB Description: Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2
PDB Compounds: (B:) Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide

SCOPe Domain Sequences for d2b3rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b3rb_ b.7.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsgavklsvsyrngtlfimvmhikdlvtedgadpnpyvktyllpdthktskrktkisrkt
rnptfnemlvysgysketlrqrelqlsvlsaeslrenfflggitlplkdfnlsketvkwy
qlta

SCOPe Domain Coordinates for d2b3rb_:

Click to download the PDB-style file with coordinates for d2b3rb_.
(The format of our PDB-style files is described here.)

Timeline for d2b3rb_: