Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (6 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187443] (1 PDB entry) |
Domain d2b34h_: 2b34 H: [162983] automated match to d1x9ga_ |
PDB Entry: 2b34 (more details), 2.14 Å
SCOPe Domain Sequences for d2b34h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b34h_ c.33.1.0 (H:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} arinptnsalfvcdlqekfasnikyfpeiittsrrlidaarilsiptivteqypkglght vptlkeglaentpifdktkfsmcipptedtlkkvqnvilvgieahvcvlqttydllergl nvhvvvdavssrshtdrhfafkqmeqagailttseatilglvggsdhpkfkevqklilts apdtglvplskl
Timeline for d2b34h_: