Lineage for d2b34h_ (2b34 H:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986330Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 986331Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 986365Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 986366Protein automated matches [190499] (6 species)
    not a true protein
  7. 986371Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187443] (1 PDB entry)
  8. 986379Domain d2b34h_: 2b34 H: [162983]
    automated match to d1x9ga_

Details for d2b34h_

PDB Entry: 2b34 (more details), 2.14 Å

PDB Description: Structure of MAR1 Ribonuclease from Caenorhabditis elegans
PDB Compounds: (H:) MAR1 Ribonuclease

SCOPe Domain Sequences for d2b34h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b34h_ c.33.1.0 (H:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
arinptnsalfvcdlqekfasnikyfpeiittsrrlidaarilsiptivteqypkglght
vptlkeglaentpifdktkfsmcipptedtlkkvqnvilvgieahvcvlqttydllergl
nvhvvvdavssrshtdrhfafkqmeqagailttseatilglvggsdhpkfkevqklilts
apdtglvplskl

SCOPe Domain Coordinates for d2b34h_:

Click to download the PDB-style file with coordinates for d2b34h_.
(The format of our PDB-style files is described here.)

Timeline for d2b34h_: