SCOPe 2.06: Domain d2amta_: 2amt A:

Lineage for d2amta_ (2amt A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Escherichia coli [TaxId:562] [69768] (14 PDB entries)
   Uniprot P62617 ! Uniprot P36663

8. Domain d2amta_: 2amt A: [162834]
   automated match to d1h48c_
   complexed with 1aa, gpp, zn

Details for d2amta_

PDB Entry: 2amt, 2.3 Å

PDB Description: Structure of 2C-Methyl-D-Erythritol 2,4-Clycodiphosphate Synthase complexed with a CDP derived fluorescent inhibitor

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d2amta_:

Sequence; same for both SEQRES and ATOM records:

>d2amta_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
gchmddvnvkattteklgftgrgegiaceavallik

Timeline for d2amta_:

• d2amta_ first appeared in SCOPe 2.01
  
• d2amta_ appears in SCOPe 2.05
  
• d2amta_ appears in SCOPe 2.07
  
• d2amta_ appears in the current release, SCOPe 2.08