SCOPe 2.05: Domain d2a08b_: 2a08 B:

Lineage for d2a08b_ (2a08 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186765] (4 PDB entries)

8. Domain d2a08b_: 2a08 B: [162642]
   automated match to d1oota_

Details for d2a08b_

PDB Entry: 2a08, 1.54 Å

PDB Description: structure of the yeast yhh6 sh3 domain

PDB Compounds: (B:) Hypothetical 41.8 kDa protein in SPO13-ARG4 intergenic region

SCOPe Domain Sequences for d2a08b_:

Sequence; same for both SEQRES and ATOM records:

>d2a08b_ b.34.2.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atavalynfageqpgdlafkkgdvitilkksdsqndwwtgrtngkegifpanyvrvs

Timeline for d2a08b_:

• d2a08b_ first appeared in SCOPe 2.01
  
• d2a08b_ appears in SCOPe 2.04
  
• d2a08b_ is called d2a08b1 in SCOPe 2.06
  
• d2a08b_ appears in the current release, SCOPe 2.08, called d2a08b1