Lineage for d1zmoh_ (1zmo H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845941Species Arthrobacter sp. [188195] (1 PDB entry)
  8. 2845942Domain d1zmoh_: 1zmo H: [162549]
    automated match to d1pwxa_

Details for d1zmoh_

PDB Entry: 1zmo (more details), 2 Å

PDB Description: Apo structure of haloalcohol dehalogenase HheA of Arthrobacter sp. AD2
PDB Compounds: (H:) halohydrin dehalogenase

SCOPe Domain Sequences for d1zmoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zmoh_ c.2.1.0 (H:) automated matches {Arthrobacter sp.}
vialvtharhfagpaavealtqdgytvvchdasfadaaerqrfesenpgtialaeqkper
lvdatlqhgeaidtivsndyiprpmnrlplegtseadirqmfealsifpilllqsaiapl
raaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnffn
nptyfptsdwennpelrervdrdvplgrlgrpdemgalitflasrraapivgqffaftgg
ylp

SCOPe Domain Coordinates for d1zmoh_:

Click to download the PDB-style file with coordinates for d1zmoh_.
(The format of our PDB-style files is described here.)

Timeline for d1zmoh_: