Lineage for d1aci__ (1aci -)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) 
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) Protein Ribosomal protein L11, C-terminal domain [46908] (2 species) 
Species Bacillus stearothermophilus [TaxId:1422] [46909] (7 PDB entries) 
Domain d1aci__: 1aci - [16246]
Details for d1aci__
PDB Entry: 1aci (more details)
PDB Description: l11 ribosomal protein rna binding domain, nmr, 20 structures
SCOP Domain Sequences for d1aci__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aci__ a.4.7.1 (-) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved
SCOP Domain Coordinates for d1aci__:
Click to download the PDB-style file with coordinates for d1aci__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aci__:
- d1aci__ first appeared (with stable ids) in SCOP 1.55
- d1aci__ appears in SCOP 1.59
- d1aci__ appears in SCOP 1.63
- d1aci__ appears in the current release, SCOPe 2.08, called d1acia_
View in 3D