Lineage for d1acia_ (1aci A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695426Species Bacillus stearothermophilus [TaxId:1422] [46909] (8 PDB entries)
  8. 2695437Domain d1acia_: 1aci A: [16246]

Details for d1acia_

PDB Entry: 1aci (more details)

PDB Description: l11 ribosomal protein rna binding domain, nmr, 20 structures
PDB Compounds: (A:) l11 ribosomal protein

SCOPe Domain Sequences for d1acia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acia_ a.4.7.1 (A:) Ribosomal protein L11, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
mtfitktppaavllkkaagiesgsgepnrnkvatikrdkvreiaelkmpdlnaasieaam
rmiegtarsmgivved

SCOPe Domain Coordinates for d1acia_:

Click to download the PDB-style file with coordinates for d1acia_.
(The format of our PDB-style files is described here.)

Timeline for d1acia_: