Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein Xylose reductase [75058] (1 species) |
Species Fungus (Candida tenuis) [TaxId:45596] [75059] (8 PDB entries) Uniprot O74237 |
Domain d1z9ab_: 1z9a B: [162420] automated match to d1jeza_ complexed with nad; mutant |
PDB Entry: 1z9a (more details), 2.4 Å
SCOPe Domain Sequences for d1z9ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9ab_ c.1.7.1 (B:) Xylose reductase {Fungus (Candida tenuis) [TaxId: 45596]} sipdiklssghlmpsigfgcwklanatageqvyqaikagyrlfdgaedygnekevgdgvk raideglvkreeifltsklwnnyhdpknvetalnktladlkvdyvdlflihfpiafkfvp ieekyppgfycgdgnnfvyedvpiletwkaleklvaagkiksigvsnfpgallldllrga tikpavlqvehhpylqqpkliefaqkagvtitayssfgpqsfvemnqgralntptlfahd tikaiaakynktpaevllrwaaqrgiavipksnlperlvqnrsfntfdltkedfeeiakl diglrfddpwdwdnipifv
Timeline for d1z9ab_: