Lineage for d1ymxb_ (1ymx B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1054971Species Escherichia coli [TaxId:562] [187306] (27 PDB entries)
  8. 1055004Domain d1ymxb_: 1ymx B: [162259]
    automated match to d1iysa_
    complexed with cfx

Details for d1ymxb_

PDB Entry: 1ymx (more details), 1.7 Å

PDB Description: x-ray crystallographic structure of ctx-m-9 beta-lactamase covalently linked to cefoxitin
PDB Compounds: (B:) beta-lactamase CTX-M-9

SCOPe Domain Sequences for d1ymxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymxb_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d1ymxb_:

Click to download the PDB-style file with coordinates for d1ymxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ymxb_: