![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
![]() | Protein Rubredoxin [57804] (8 species) |
![]() | Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries) |
![]() | Domain d1yk5d_: 1yk5 D: [162235] automated match to d1bq8a_ complexed with fe |
PDB Entry: 1yk5 (more details), 1.79 Å
SCOPe Domain Sequences for d1yk5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yk5d_ g.41.5.1 (D:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]} makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
Timeline for d1yk5d_: