Lineage for d1yk5d_ (1yk5 D:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1705991Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1706000Protein Rubredoxin [57804] (8 species)
  7. 1706051Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries)
  8. 1706057Domain d1yk5d_: 1yk5 D: [162235]
    automated match to d1bq8a_
    complexed with fe

Details for d1yk5d_

PDB Entry: 1yk5 (more details), 1.79 Å

PDB Description: Pyrococcus abyssi rubredoxin
PDB Compounds: (D:) rubredoxin

SCOPe Domain Sequences for d1yk5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk5d_ g.41.5.1 (D:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]}
makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie

SCOPe Domain Coordinates for d1yk5d_:

Click to download the PDB-style file with coordinates for d1yk5d_.
(The format of our PDB-style files is described here.)

Timeline for d1yk5d_: