PDB entry 1yk5
View 1yk5 on RCSB PDB site
Description: Pyrococcus abyssi rubredoxin
Class: Electron transport
Keywords: Electron transport
Deposited on
2005-01-17, released
2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.158
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: rubredoxin
Species: Pyrococcus abyssi [TaxId:29292]
Gene: rub
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1yk5a_ - Chain 'B':
Compound: rubredoxin
Species: Pyrococcus abyssi [TaxId:29292]
Gene: rub
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1yk5b_ - Chain 'C':
Compound: rubredoxin
Species: Pyrococcus abyssi [TaxId:29292]
Gene: rub
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1yk5c_ - Chain 'D':
Compound: rubredoxin
Species: Pyrococcus abyssi [TaxId:29292]
Gene: rub
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1yk5d_ - Heterogens: FE, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1yk5A (A:)
makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1yk5B (B:)
makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
- Chain 'C':
Sequence, based on SEQRES records: (download)
>1yk5C (C:)
makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
Sequence, based on observed residues (ATOM records): (download)
>1yk5C (C:)
akwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1yk5D (D:)
makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie