Lineage for d1yjxj_ (1yjx J:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143621Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2143622Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2143623Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2143675Protein automated matches [190196] (7 species)
    not a true protein
  7. 2143695Species Human (Homo sapiens) [TaxId:9606] [186938] (11 PDB entries)
  8. 2143725Domain d1yjxj_: 1yjx J: [162228]
    automated match to d1e58a_
    complexed with cit, cl

Details for d1yjxj_

PDB Entry: 1yjx (more details), 2.8 Å

PDB Description: Crystal structure of human B type phosphoglycerate mutase
PDB Compounds: (J:) phosphoglycerate mutase 1

SCOPe Domain Sequences for d1yjxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yjxj_ c.60.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvrka
meav

SCOPe Domain Coordinates for d1yjxj_:

Click to download the PDB-style file with coordinates for d1yjxj_.
(The format of our PDB-style files is described here.)

Timeline for d1yjxj_: