Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) |
Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins) |
Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
Species Pyrococcus furiosus [TaxId:2261] [64099] (7 PDB entries) |
Domain d1x12b_: 1x12 B: [162025] automated match to d1ioia_ mutant |
PDB Entry: 1x12 (more details), 2 Å
SCOPe Domain Sequences for d1x12b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x12b_ c.56.4.1 (B:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Pyrococcus furiosus [TaxId: 2261]} mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk gqvppsmsyemdleavkvaievaleell
Timeline for d1x12b_: