SCOPe 2.01: Domain d1w20c_: 1w20 C:

Lineage for d1w20c_ (1w20 C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.1: Sialidases [50939] (3 families)

5. Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)

6. Protein automated matches [190279] (4 species)
   not a true protein

7. Species Influenza virus type a [TaxId:11320] [188063] (1 PDB entry)

8. Domain d1w20c_: 1w20 C: [161882]
   automated match to d5nn9a_
   complexed with bma, ca, gol, man, nag, sia

Details for d1w20c_

PDB Entry: 1w20, 2.08 Å

PDB Description: structure of neuraminidase from english duck subtype n6 complexed with 30 mm sialic acid (nana, neu5ac), crystal soaked for 3 hours at 291 k

PDB Compounds: (C:) neuraminidase subtype n6

SCOPe Domain Sequences for d1w20c_:

Sequence; same for both SEQRES and ATOM records:

>d1w20c_ b.68.1.1 (C:) automated matches {Influenza virus type a [TaxId: 11320]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

Timeline for d1w20c_:

• d1w20c_ is new in SCOPe 2.01-stable
  
• d1w20c_ appears in SCOPe 2.02
  
• d1w20c_ appears in the current release, SCOPe 2.08