Lineage for d1vzmc_ (1vzm C:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243724Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. 1243725Superfamily g.32.1: GLA-domain [57630] (2 families) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. 1243782Family g.32.1.0: automated matches [191493] (1 protein)
    not a true family
  6. 1243783Protein automated matches [190799] (1 species)
    not a true protein
  7. 1243784Species Argyrosomus regius [TaxId:172269] [188062] (1 PDB entry)
  8. 1243787Domain d1vzmc_: 1vzm C: [161875]
    automated match to d1q3ma_
    complexed with mg

Details for d1vzmc_

PDB Entry: 1vzm (more details), 1.4 Å

PDB Description: osteocalcin from fish argyrosomus regius
PDB Compounds: (C:) Osteocalcin

SCOPe Domain Sequences for d1vzmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vzmc_ g.32.1.0 (C:) automated matches {Argyrosomus regius [TaxId: 172269]}
ltlaqteslrevcetnmacdemadaqgivaayqafygpipf

SCOPe Domain Coordinates for d1vzmc_:

Click to download the PDB-style file with coordinates for d1vzmc_.
(The format of our PDB-style files is described here.)

Timeline for d1vzmc_: