SCOPe 2.06: Domain d1vgja_: 1vgj A:

Lineage for d1vgja_ (1vgj A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.0: automated matches [191492] (1 protein)
   not a true family

6. Protein automated matches [190796] (6 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [188054] (2 PDB entries)

8. Domain d1vgja_: 1vgj A: [161856]
   automated match to d1iuha_

Details for d1vgja_

PDB Entry: 1vgj, 1.94 Å

PDB Description: Crystal structure of 2'-5' RNA ligase from Pyrococcus horikoshii

PDB Compounds: (A:) Hypothetical protein PH0099

SCOPe Domain Sequences for d1vgja_:

Sequence; same for both SEQRES and ATOM records:

>d1vgja_ d.61.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrafiaidvnesvrdslvraqdyigskeakikfverenlhitlkflgeiteeqaeeikni
lkkiaekykkhevkvkgigvfpnpnyirviwagiendeiiremareiedelaklgfkkeg
nfvahitlgrvkfvkdklgltmklkelanedfgsfvvdaielkkstltpkgpiyetlarf
else

Timeline for d1vgja_:

• d1vgja_ first appeared in SCOPe 2.01
  
• d1vgja_ appears in SCOPe 2.05
  
• d1vgja_ appears in SCOPe 2.07
  
• d1vgja_ appears in the current release, SCOPe 2.08